Online Inquiry
CENPI Antibody
SPA-02152
| Size | Price |
| 50 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | CENPI |
| Gene Abbr. | CENPI |
| Gene ID | 2491 |
| Full Name | centromere protein I |
| Alias | CENP-I, FSHPRH1, LRPR1 |
| Introduction | CENPI is involved in the response of gonadal tissues to follicle-stimulating hormone. The gene encoding CENPI is also a potential candidate for human X-linked disorders of gonadal development and gametogenesis. The product of this gene is involved in the response of gonadal tissues to follicle-stimulating hormone. This gene is also a potential candidate for human X-linked disorders of gonadal development and gametogenesis. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Immunogen | Synthetic peptide directed towards the N-terminal region of Human CENPI. Peptide sequence: SKNISKHGQNNPVGDYEHADDQAEEDALQMAVGYFEKGPIKASQNKDKTL The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB |
| Reactivity | Human, Porcine |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS, 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.