CD77 Synthase Antibody - CD BioSciences

service-banner

CD77 Synthase Antibody

CD77 Synthase Antibody

SPA-02077

Size Price
0.1 mL Online Inquiry
25 µL Online Inquiry
More Options Online Inquiry
Target Information
Target Name CD77 Synthase
Gene Abbr. A4GALT
Gene ID 53947
Full Name alpha 1,4-galactosyltransferase (P blood group)
Alias A14GALT, A4GALT1, Gb3S, P(k), P1
Introduction The protein encoded by this gene catalyzes the transfer of galactose to lactosylceramide to form globotriaosylceramide, which has been identified as the P(k) antigen of the P blood group system. The encoded protein, which is a type II membrane protein found in the Golgi, is also required for the synthesis of the bacterial verotoxins receptor.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Synthetic peptides corresponding to A4GALT(alpha 1,4-galactosyltransferase (globotriaosylceramide synthase)) The peptide sequence was selected from the middle region of A4GALT. Peptide sequence VLNGAFLAFERRHEFMALCMRDFVDHYNGWIWGHQGPQLLTRVFK The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB
Dilutions Western Blot (1:100-1:2000)
Reactivity Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit
Storage & Handling
Storage Buffer PBS and 2% Sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at -20 °C.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.