CD11c/ITGAX Antibody - CD BioSciences

service-banner

CD11c/ITGAX Antibody

CD11c/ITGAX Antibody

SPA-06262

Size Price
25 µg Online Inquiry
500 µg Online Inquiry
More Options Online Inquiry
Target Information
Target Name Integrin
Gene Abbr. ITGAX
Gene ID 3687
Full Name integrin subunit alpha X
Alias CD11C, SLEB6
Introduction CD11c (integrin αX, ITGAX) is a transmembrane glycoprotein that forms an α/β heterodimer with CD18 (integrin β2), which interacts with a variety of extracellular matrix molecules and cell surface proteins. CD11c is primarily used as a dendritic cell marker. Dendritic cells can be classified into two major types: CD11c+ conventional dendritic cells that specialize in antigen presentation, and CD11c- plasmacytoid dendritic cells that specialize in type I interferon production. CD11c expression has also been observed on activated NK cells, subsets of B cells, monocytes, granulocytes, and some B cell malignancies including hairy cell leukemia.
Product Details
Host Mouse
Clonality Monoclonal
Clone No. CL1831
Isotype IgG1
Immunogen Recombinant Protein corresponding to amino acids: QDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRV.
Usage
Application WB, IHC
Dilutions Western Blot (1 µg/mL); Immunohistochemistry (1:200-1:500)
Reactivity Human
Specificity Specificity of human CD11c antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.