Online Inquiry
CD103/ITGAE Antibody
SPA-06180
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | Integrin |
| Gene Abbr. | ITGAE |
| Gene ID | 3682 |
| Full Name | integrin subunit alpha E |
| Alias | CD103, HUMINAE |
| Introduction | Cluster of differentiation molecule 103 (CD103)/Integrin, alpha E (ITGAE) is a transmembrane protein forming heterodimers that are composed of α and β subunits. CD103/ITGAE is expressed by subsets of CD4+ and CD8+ T cells, dendritic cells, and mast cells in mucosal tissues. The heterodimer composed of CD103/ITGAE and integrin beta 7 interacts with E-cadherin, a cellular adhesion molecule found on epithelial cells. The CD103/ITGAE and integrin beta 7 complex plays a role in thymocyte proliferation, intestinal T cell homing, and the antitumor immune response. Studies have shown that the presence of CD103/ITGAE(+) immune cells can be used as markers for a favorable prognosis in different epithelial cancers. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: CEEDCFSNASVKVSYQLQTPEGQTDHPQPILDRYTEPFAIFQLPYEKACKNKLFCVAELQLATTVSQQELVVGLTKELTLN. |
| Usage | |
|---|---|
| Application | IHC |
| Dilutions | Immunohistochemistry (1:50-1:200) |
| Reactivity | Human |
| Specificity | Specificity of human Integrin alpha E/CD103 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.