CCR7 Antibody - CD BioSciences

service-banner

CCR7 Antibody

CCR7 Antibody

SPA-01780

Size Price
0.02 mg Online Inquiry
0.1 mg Online Inquiry
More Options Online Inquiry
Target Information
Target Name CCR7
Gene Abbr. CCR7
Gene ID 1236
Full Name C-C motif chemokine receptor 7
Alias BLR2, CC-CKR-7, CCR-7, CD197, CDw197
Introduction CCR7 (Chemokine Receptor 7; also CD197) is a 7 transmembrane (7TM) G protein-coupled chemokine receptor for the homeostatic chemokines CCL19/MIP-3 beta and CCL21/6Ckine. CCL19 and CCL21 are constitutively expressed by high endothelial venule epithelial cells or fibroblastic reticular cells in secondary lymphoid organs. CCR7 is upregulated on dendritic cells, naïve and memory T cells, Treg, NK cells, and B cells following inflammatory stimulation. Its expression enables the function of immune cell trafficking to and retention in regional lymph nodes for expansion of the adaptive immune response. Human CCR7 shares 87% amino acid sequence identity with mouse CCR7.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to the following amino acid sequence: QDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKA.
Usage
Application IF
Dilutions Immunofluorescence (0.25-2 µg/mL)
Reactivity Human
Specificity Specificity of human CCR7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.