Online Inquiry
CCL8/MCP-2 Antibody
SPA-01706
| Size | Price |
| 0.1 mg | Online Inquiry |
| 0.025 mg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | CCL8/MCP-2 |
| Gene Abbr. | CCL8 |
| Gene ID | 6355 |
| Full Name | C-C motif chemokine ligand 8 |
| Alias | HC14, MCP-2, MCP2, SCYA10, SCYA8 |
| Introduction | CCL8, also known as Monocyte Chemoattractant Protein 2 (MCP-2), is an inflammatory CC chemokine that attracts monocytes, eosinophils and basophils. It is produced by many cell types and signals through interactions with CCR1, CCR2, CCR3 and CCR5. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Synthetic peptide directed towards the middle region of human CCL8. Peptide sequence SYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP. The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB, IHC |
| Dilutions | Western Blot (1:1000) |
| Reactivity | Human |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS and 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at -20 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.