Online Inquiry
CCL23/Ck beta 8-1/MIP3 Antibody
SPA-01619
Size | Price |
25 µg | Online Inquiry |
500 µg | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | CCL23/MIP3 |
Gene Abbr. | CCL23 |
Gene ID | 6368 |
Full Name | C-C motif chemokine ligand 23 |
Alias | CK-BETA-8, CKb8, Ckb-8, Ckb-8-1, MIP-3 |
Introduction | This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity on resting T lymphocytes and monocytes, lower activity on neutrophils and no activity on activated T lymphocytes. The protein is also a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line. In addition, the product of this gene is a potent agonist at CC chemokine receptor 1. Two alternatively spliced variants encoding different active isoforms have been identified. [provided by RefSeq] |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to amino acids: NPVLLDMLWRRKIGPQMTLSHAAGFHATSADCCISYTPRSIPCSLLESYFETNS. |
Usage | |
---|---|
Application | IHC |
Dilutions | Immunohistochemistry (1:50-1:200) |
Reactivity | Human |
Specificity | Specificity of human CCL23/Ck beta 8-1/MIP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.