Online Inquiry
CCL1/I-309/TCA-3 Antibody
SPA-01499
| Size | Price |
| 25 µg | Online Inquiry |
| 500 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | CCL1/I-309/TCA-3 |
| Gene Abbr. | CCL1 |
| Gene ID | 6346 |
| Full Name | C-C motif chemokine ligand 1 |
| Alias | I-309, P500, SCYA1, SISe, TCA3 |
| Introduction | This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine is secreted by activated T cells and displays chemotactic activity for monocytes but not for neutrophils. It binds to the chemokine receptor CCR8. [provided by RefSeq] |
| Product Details | |
|---|---|
| Host | Mouse |
| Clonality | Monoclonal |
| Clone No. | 4E4 |
| Isotype | IgG2B Kappa |
| Immunogen | CCL1 (NP_002972, 24 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK. |
| Usage | |
|---|---|
| Application | ELISA |
| Reactivity | Human |
| Specificity | CCL1 - chemokine (C-C motif) ligand 1. |
| Storage & Handling | |
|---|---|
| Storage Buffer | In 1X PBS, pH 7.4. |
| Preservative | No Preservative |
| Storage Temp. | Aliquot and store at -20 °C or -80 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.