CCL19/MIP-3 beta Antibody - CD BioSciences

service-banner

CCL19/MIP-3 beta Antibody

CCL19/MIP-3 beta Antibody

SPA-01559

Size Price
0.1 mL Online Inquiry
More Options Online Inquiry
Target Information
Target Name CCL19/MIP-3 beta
Gene Abbr. CCL19
Gene ID 6363
Full Name C-C motif chemokine ligand 19
Alias CKb11, ELC, MIP-3b, MIP3B, SCYA19
Introduction MIP-3 beta, also known as ELC (EBI1-Ligand Chemokine), is one of many novel beta chemokines identified through bioinformatics. MIP-3 beta cDNA encodes a 98 amino acid (aa) residue precursor protein with a predicted 21 aa residue signal peptide that is cleaved to form the 77 aa residue mature secreted protein. MIP-3 beta is distantly related to other beta chemokines (20-30% aa sequence identity) and the gene for MIP-3 beta has been mapped to chromosome 9p13 rather than chromosome 17 where the genes for many human beta chemokines are clustered. MIP-3 beta has been shown to be constitutively expressed in various lymphoid tissues (including thymus, lymph nodes, appendix and spleen). The expression of MIP-3 beta is down-regulated by the anti-inflammatory cytokine IL-10. MIP-3 beta has been shown to be a unique functional ligand for CCR7 (previously referred to as the Epstein-Barr virus-induced gene 1 (EBI1) orphan receptor), a chemokine receptor that is expressed in various lymphoid tissues and activated B and T lymphocytes. EBI1 is strongly up-regulated in B cells infected with Epstein-Barr virus and T cells infected with herpesvirus 6 or 7.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to the following amino acid sequence: LLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS.
Usage
Application IHC
Dilutions Immunohistochemistry (1:500-1:1000)
Reactivity Human
Specificity Specificity of human CCL19/MIP-3 beta antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.