Online Inquiry
CCL16/HCC-4/LEC Antibody
SPA-01534
| Size | Price |
| 0.1 mg | Online Inquiry |
| 0.025 mg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | CCL16/HCC-4/LEC |
| Gene Abbr. | CCL16 |
| Gene ID | 6360 |
| Full Name | C-C motif chemokine ligand 16 |
| Alias | CKb12, HCC-4, ILINCK, LCC-1, LEC |
| Introduction | Human HCC-4, also named NCC-4, liver-expressed chemokine (LEC), and lymphocyte and monocyte chemoattractant (LMC), is a novel CC chemokine identified through bioinformatics. HCC-4 cDNA encodes a 120 amino acid (aa) residue precursor protein with a 23 aa residue predicted signal peptide that is cleaved to generate a 97 aa residue mature protein. HCC-4 is distantly related to other CC chemokines, exhibiting less than 30% aa sequence identity. Among these CC chemokines, HCC-4 has the most similarity to HCC-1. Two potential polyadenylation signals are present on the human HCC-4 gene, and as a result, two transcripts containing approximately 1,500 base pairs and 500 base pairs have been detected. HCC-4 is expressed weakly by some lymphocytes, including NK cells, gamma δ T cells, and some T cell clones. The expression of HCC-4 in monocytes is highly upregulated in the presence of IL-10. The HCC-4 gene has been mapped to chromosome 17q where multiple CC chemokines are clustered. Recombinant HCC-4 has been shown to chemoattract human monocytes and THP-1 cells but not resting lymphocytes or neutrophils. HCC-4 has also been found to suppress proliferation of myeloid progenitor cells. The HCC-4 induced calcium flux in THP-1 cells can be desensitized by prior exposure to RANTES, suggesting that HCC-4 and RANTES share the same receptor in THP-1 cells. Shoudai, K. et al. (1998) Biochim. Biophys. Acta 1396:273. Hedrick, J. et al. (1998) Blood 91:4242. Youn, B-S. et al. (1998) BBRC 247:217. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Synthetic peptides corresponding to the N terminal of CCL16. Immunizing peptide sequence SLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKAL. The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB |
| Dilutions | Western Blot (1.0 µg/mL) |
| Reactivity | Human |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS and 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at -20 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.