Online Inquiry
CCL14/HCC-1/HCC-3 Antibody
SPA-01521
Size | Price |
25 µg | Online Inquiry |
500 µg | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | CCL14/HCC-1/HCC-3 |
Gene Abbr. | CCL14 |
Gene ID | 6358 |
Full Name | C-C motif chemokine ligand 14 |
Alias | CC-1, CC-3, CKB1, HCC-1, HCC-1(1-74) |
Introduction | This gene, CCL14, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene induces changes in intracellular calcium concentration and enzyme release in monocytes. This gene expresses both monocistronic and bicistronic transcripts. Bicistronic transcripts include the upstream cytokine gene CCL15. In addition, CCL14 undergoes alternative splicing in the bicistronic transcripts; it is unknown if its monocistronic transcript is also subject to alternative splicing. [provided by RefSeq] |
Product Details | |
---|---|
Host | Mouse |
Clonality | Monoclonal |
Clone No. | 1F12 |
Isotype | IgG2B Kappa |
Immunogen | CCL14 (AAH45165, 20 a.a. ~ 93 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN. |
Usage | |
---|---|
Application | WB, ELISA |
Reactivity | Human |
Specificity | CCL14 - chemokine (C-C motif) ligand 14. |
Storage & Handling | |
---|---|
Storage Buffer | In 1X PBS, pH 7.4. |
Preservative | No Preservative |
Storage Temp. | Aliquot and store at -20 °C or -80 °C. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.