Online Inquiry
Caspase-8 Antibody
SPA-01436
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | Caspase-8 |
| Gene Abbr. | CASP8 |
| Gene ID | 841 |
| Full Name | caspase 8 |
| Alias | ALPS2B, CAP4, Casp-8, FLICE, MACH |
| Introduction | Apoptosis induced through the CD95 receptor (Fas/APO-1) and tumor necrosis factor receptor 1 (TNFR1) activates caspase-8 and leads to the release of the caspase-8 active fragments, p18 and p10. Activated caspase-8 cleaves and activates downstream effector caspases such as caspase-1, -3, -6, and -7. Caspase-3 ultimately elicits the morphological hallmarks of apoptosis, including DNA fragmentation and cell shrinkage. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: LGEGKLDILKRVCAQINKSLLKIINDYEEFSKGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICC. |
| Usage | |
|---|---|
| Application | WB, IHC |
| Dilutions | Western Blot (0.04-0.4 µg/mL); Immunohistochemistry (1:50-1:200) |
| MW(KDa) | 18, 43, 57 |
| Reactivity | Human |
| Specificity | Specificity of human Caspase-8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.