Online Inquiry
CARD10 Antibody
SPA-01344
Size | Price |
100 µL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | CARD10 |
Gene Abbr. | CARD10 |
Gene ID | 29775 |
Full Name | caspase recruitment domain family member 10 |
Alias | BIMP1, CARMA3 |
Introduction | Apoptosis is related to many diseases and development. Cell death signals are transduced by death domain (DD), death effector domain (DED), and caspase recruitment domain (CARD) containing molecules. CARD containing proteins include some caspases, Apaf-1, CARD4, IAPs, RICK, ARC, RAIDD, Bcl-10, and ASC. A novel CARD-containing protein was recently identified and designated CARD10. This protein belongs to the membrane-associated guanylate kinase-like (MAGUK) family of proteins that can function as molecular scaffolds that assist assembly of signal transduction molecules. CARD 10 interacts with Bcl-10, a Bcl protein that promotes apoptosis, caspase-9 maturation and activation of NF-kappaB. CARD 10 and the related protein CARMA1 also associate with NEMO, the regulatory subunit of the IkappaK complex, demonstrating its importance in the regulation of NF-kappaB transcription factor activation. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to the following amino acid sequence: LTTLTSLEGTKALLEVQLQRAQGGTCLKACASSHSLCSNLSSTWSLSEFPSPLGGPEATGEAAVMGGPEPHNSEEATDSEKEINRLSILPF. |
Usage | |
---|---|
Application | IF |
Dilutions | Immunofluorescence (0.25-2 µg/mL) |
Reactivity | Human |
Specificity | Specificity of human CARD10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.