Calpain 6 Antibody - CD BioSciences

service-banner

Calpain 6 Antibody

Calpain 6 Antibody

SPA-01312

Size Price
0.1 mg Online Inquiry
0.025 mg Online Inquiry
More Options Online Inquiry
Target Information
Target Name Calpain 6
Gene Abbr. CAPN6
Gene ID 827
Full Name calpain 6
Alias CANPX, CAPNX, CalpM, DJ914P14.1
Introduction Calpains make up a ubiquitously expressed, well-conserved family of calcium-dependent cysteine proteases. The calpain proteins are heterodimers consisting of an invariant small subunit and variable large subunits. This large subunit possesses a cysteine protease domain, and both subunits possess calcium-binding domains. Calpains have been implicated in neurodegenerative processes as their activation can be triggered by calcium influx and oxidative stress. Calpain 6 (CAPN6) is most similar to Calpain 5; the C-terminal region of CAPN6 lacks homology to the calmodulin-like domain of other vertebrate calpains. CAPN6 is thought to be involved in the regulation of microtubule dynamics and cytoskeletal organization. CAPN6 has also been recently identified as an HIV dependency factor (HDF), suggesting that CAPN6 may be an important drug target in HIV treatment.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Immunogen Synthetic peptide directed towards the middle region of human Calpain 6. Peptide sequence: TIPNHKEQEWDPQKTEKYAGIFHFRFWHFGEWTEVVIDDLLPTINGDLVF The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB
Reactivity Human
Storage & Handling
Storage Buffer PBS, 2% Sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.