Online Inquiry
Calpain 6 Antibody
SPA-01311
Size | Price |
0.1 mg | Online Inquiry |
0.025 mg | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | Calpain 6 |
Gene Abbr. | CAPN6 |
Gene ID | 827 |
Full Name | calpain 6 |
Alias | CANPX, CAPNX, CalpM, DJ914P14.1 |
Introduction | Calpains make up a ubiquitously expressed, well-conserved family of calcium-dependent cysteine proteases. The calpain proteins are heterodimers consisting of an invariant small subunit and variable large subunits. This large subunit possesses a cysteine protease domain, and both subunits possess calcium-binding domains. Calpains have been implicated in neurodegenerative processes as their activation can be triggered by calcium influx and oxidative stress. Calpain 6 (CAPN6) is most similar to Calpain 5; the C-terminal region of CAPN6 lacks homology to the calmodulin-like domain of other vertebrate calpains. CAPN6 is thought to be involved in the regulation of microtubule dynamics and cytoskeletal organization. CAPN6 has also been recently identified as an HIV dependency factor (HDF), suggesting that CAPN6 may be an important drug target in HIV treatment. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to amino acids:TLDMPKMSCWNLARGYPKVVTQITVHSAEDLEKKYANETVNPYLVIKCGKEEVRSPVQKNTVHAIFDTQAIFYRRTTDIPIIVQVWNSRKFCDQFLGQ. |
Usage | |
---|---|
Application | WB, IF |
Dilutions | Western Blot (0.04-0.4 µg/mL); Immunofluorescence (0.25-2 µg/mL) |
Reactivity | Human, Mouse, Rat |
Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.