CABLES2 Antibody - CD BioSciences

service-banner

CABLES2 Antibody

CABLES2 Antibody

SPA-01295

Size Price
100 µL Online Inquiry
More Options Online Inquiry
Target Information
Target Name CABLES2
Gene Abbr. CABLES2
Gene ID 81928
Full Name Cdk5 and Abl enzyme substrate 2
Alias C20orf150, dJ908M14.2, ik3-2
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to the following amino acid sequence: AKFLYPTNALVTHKSDSHGLLPTPRPSVPRTLPGSRHKPAPTKSAPASTELGSDVGDTLEYNPN.
Usage
Application IF
Dilutions Immunofluorescence (0.25-2 µg/mL)
Reactivity Human
Specificity Specificity of human CABLES2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.