Online Inquiry
c-Jun Antibody
SPA-01220
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | c-Jun |
| Gene Abbr. | JUN |
| Gene ID | 3725 |
| Full Name | Jun proto-oncogene, AP-1 transcription factor subunit |
| Alias | AP-1, AP1, c-Jun, cJUN, p39 |
| Introduction | c-Jun is a member of the Jun family containing c-Jun, JunB, and JunD, and is a component of the transcription factor activator protein-1 (AP-1). AP-1 is composed of dimers of Fos, Jun, and ATF family members and binds to and activates transcription at TRE/AP-1 elements. Extracellular signals including growth factors, chemokines, and stress activate AP-1-dependent transcription. The transcriptional activity of c-Jun is regulated by phosphorylation at Ser63 and Ser73 through SAPK/JNK. Knock-out studies in mice have shown that c-Jun is essential for embryogenesis and subsequent studies have demonstrated roles for c-Jun in various tissues and developmental processes including axon regeneration liver regeneration and T cell development. AP-1 regulated genes exert diverse biological functions including cell proliferation, differentiation, and apoptosis, as well as transformation, invasion and metastasis, depending on cell type and context. Other target genes regulate survival, as well as hypoxia and angiogenesis. Research studies have implicated c-Jun as a promising therapeutic target for cancer, vascular remodeling, acute inflammation, and rheumatoid arthritis. |
| Product Details | |
|---|---|
| Host | Mouse |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | JUN (AAH68522.1, 1 a.a. - 331 a.a.) full-length human protein. MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF. |
| Usage | |
|---|---|
| Application | WB |
| MW(KDa) | 43, 48 |
| Reactivity | Human |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.4). |
| Preservative | No Preservative |
| Storage Temp. | Aliquot and store at -20 °C or -80 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.