Online Inquiry
c-Abl Antibody
SPA-01170
Size | Price |
25 µg | Online Inquiry |
100 µg | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | c-Abl |
Gene Abbr. | ABL1 |
Gene ID | 25 |
Full Name | ABL proto-oncogene 1, non-receptor tyrosine kinase |
Alias | ABL, BCR-ABL, CHDSKM, JTK7, bcr/abl |
Introduction | The c-Abl proto-oncogene encodes a nonreceptor protein tyrosine kinase that is ubiquitously expressed and highly conserved in metazoan evolution. c-Abl protein is distributed in both the nucleus and the cytoplasm of cells. It is implicated in regulating cell proliferation, differentiation, apoptosis, cell adhesion, and stress responses. c-Abl kinase activity is increased in vivo by diverse physiological stimuli including integrin activation; PDGF stimulation; and binding to c-Jun, Nck, and RFX1. The in vivo mechanism for regulation of c-Abl kinase activity is not completely understood. Tyr245 is located in the linker region between the SH2 and catalytic domains. This positioning is conserved among Abl family members. Phosphorylation at Tyr245 is involved in the activation of c-Abl kinase. In addition, phosphorylation at Tyr412, which is located in the kinase activation loop of c-Abl, is required for kinase activity. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to amino acids: TEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGENRSDQVTRGTVTPPPRLVKKNEEAADEVFKDIMESSP. |
Usage | |
---|---|
Application | IF, IHC |
Dilutions | Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:50-1:200) |
MW(KDa) | 135 (c-Abl), 210 (Bcr-Abl) |
Reactivity | Human |
Specificity | Specificity of human c-Abl antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.