Online Inquiry
BTN2A1 Antibody
SPA-01159
Size | Price |
0.1 mL | Online Inquiry |
25 µL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | BTN2A1 |
Gene Abbr. | BTN2A1 |
Gene ID | 11120 |
Full Name | butyrophilin subfamily 2 member A1 |
Alias | BK14H9.1, BT2.1, BTF1, BTN2.1, DJ3E1.1 |
Introduction | This gene is a member of the BTN2 subfamily of genes, which encode proteins belonging to the butyrophilin protein family. The gene is located in a cluster on chromosome 6, consisting of seven genes belonging to the expanding B7/butyrophilin-like group, a subset of the immunoglobulin gene superfamily. The encoded protein is an integral plasma membrane B box protein involved in lipid, fatty-acid and sterol metabolism. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Immunogen | Synthetic peptide directed towards the middle region of human BTN2A1. Peptide sequence: CRDSVERKGEVLLIPQNGFWTLEMHKGQYRAVSSPDRILPLKESLCRVGV The peptide sequence for this immunogen was taken from within the described region. |
Usage | |
---|---|
Application | WB |
Reactivity | Human |
Storage & Handling | |
---|---|
Storage Buffer | PBS, 2% Sucrose. |
Preservative | 0.09% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.