Online Inquiry
BNIP3L Antibody
SPA-01134
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | BNIP3L |
| Gene Abbr. | BNIP3L |
| Gene ID | 665 |
| Full Name | BCL2 interacting protein 3 like |
| Alias | BNIP3a, NIX |
| Introduction | BNIP3L/NIX is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family, which is involved in the regulation of apoptosis. Like other BH3-only proteins, NIX is believed to possess tumor suppressing functions; NIX localizes to the mitochondria and interacts with BCL2 and BCL-X in a pro-apoptotic manner. NIX shares a high level of sequence homology with BNIP3, and like BNIP3 activates apoptosis through its C-terminal transmembrane domain but not via its BH3 domain. Hypoxia is believed to be a principle regulator of NIX activity, making NIX a key factor in hypoxia-induced tumor cell death and heart disease. In addition, NIX has been implicated in mitophagy, a specific form of autophagy; due to its dual role, NIX is an interesting target to examine the relationship between apoptosis and autophagy. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: SNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSDWSSRPENIPPKEFHFRHPKRSVSLSMRKSGAMK. |
| Usage | |
|---|---|
| Application | IF, IHC |
| Dilutions | Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:200-1:500) |
| Reactivity | Human, Mouse, Rat |
| Specificity | Specificity of human BNIP3L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.