BNIP3L Antibody - CD BioSciences

service-banner

BNIP3L Antibody

BNIP3L Antibody

SPA-01134

Size Price
25 µg Online Inquiry
100 µg Online Inquiry
More Options Online Inquiry
Target Information
Target Name BNIP3L
Gene Abbr. BNIP3L
Gene ID 665
Full Name BCL2 interacting protein 3 like
Alias BNIP3a, NIX
Introduction BNIP3L/NIX is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family, which is involved in the regulation of apoptosis. Like other BH3-only proteins, NIX is believed to possess tumor suppressing functions; NIX localizes to the mitochondria and interacts with BCL2 and BCL-X in a pro-apoptotic manner. NIX shares a high level of sequence homology with BNIP3, and like BNIP3 activates apoptosis through its C-terminal transmembrane domain but not via its BH3 domain. Hypoxia is believed to be a principle regulator of NIX activity, making NIX a key factor in hypoxia-induced tumor cell death and heart disease. In addition, NIX has been implicated in mitophagy, a specific form of autophagy; due to its dual role, NIX is an interesting target to examine the relationship between apoptosis and autophagy.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: SNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSDWSSRPENIPPKEFHFRHPKRSVSLSMRKSGAMK.
Usage
Application IF, IHC
Dilutions Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:200-1:500)
Reactivity Human, Mouse, Rat
Specificity Specificity of human BNIP3L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.