Online Inquiry
BMP-2 Antibody
SPA-01088
Size | Price |
0.025 mL | Online Inquiry |
0.1 mL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | BMP-2 |
Gene Abbr. | BMP2 |
Gene ID | 650 |
Full Name | bone morphogenetic protein 2 |
Alias | BDA2, BMP2A, SSFSC |
Introduction | Bone morphogenic protein 2 is required for effective healing of fractures in bone. It is necessary for the expression of transcription factors that regulate osteogenesis and differentiation of progenitor cells into mature osteoblasts. Embryologically, BMP2 is important in mesenchymal maturation to fetal valves. The same mechanism of maturation is also utilized by tumor molecular machinery once mesenchymal stem cells are recruited to tumor microenvironments, leading to many recent attempts to generate BMP inhibitors in the treatment of ovarian and colon cancer. The activity of BMP2 is antagonized by the activity of Bambi and Crim1. BMP2 is an interesting target for distinguishing the mechanism by which normal and necessary maturation processes are mutated in tumorigenesis. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to the following amino acid sequence: RLVNQNASRWESFDVTPAVMRWTAQGHANHGFVVEVAHLEEKQGVSKRHVRIS. |
Usage | |
---|---|
Application | WB, IF |
Dilutions | Western Blot (0.04-0.4 µg/mL); Immunofluorescence (0.25-2 µg/mL) |
Reactivity | Human, Rat |
Specificity | Specificity of human BMP-2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.