Online Inquiry
Beta-endorphin Antibody
SPA-03408
| Size | Price |
| 0.05 mL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | Endorphin |
| Gene Abbr. | POMC |
| Gene ID | 5443 |
| Full Name | proopiomelanocortin |
| Alias | ACTH, CLIP, LPH, MSH, NPP |
| Introduction | Beta-endorphin is an endogenous opioid peptide neurotransmitter found in the neurons of both the central and peripheral nervous system. Beta-endorphin is a peptide, 31 amino acids long, resulting from processing of the precursor pro-opiomelanocortin (POMC). beta-endorphin is found in neurons of the hypothalamus as well as the pituitary gland. It is an agonist of the opioid receptors, with evidence suggesting that it serves as the endogenous ligand of the u-opioid receptor, the same receptor to which the chemicals extracted from opium, such as morphine and codeine, have their analgesic and addictive effects |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Antiserum to beta Endorphin was raised in rabbits by using the N-terminal portion of bovine beta Endorphin conjugated to thyroglobulin. (YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE). |
| Usage | |
|---|---|
| Application | IF, IHC |
| Dilutions | Immunofluorescence (15 µg/mL); Immunohistochemistry (1:10-1:500) |
| Reactivity | Human, Mouse, Rat |
| Specificity | Cross reactivity: beta-endorphin (100%), Met-enkephalin (0.03%), Leu-enkephalin (0.02%), beta-lipotropin (0.34%). |
| Storage & Handling | |
|---|---|
| Storage Buffer | 10 mM PBS. |
| Preservative | 0.1% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.