Online Inquiry
BCA3 Antibody
SPA-00920
| Size | Price |
| 0.05 mg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | BCA3 |
| Gene Abbr. | AKIP1 |
| Gene ID | 56672 |
| Full Name | A-kinase interacting protein 1 |
| Alias | BCA3, C11orf17 |
| Product Details | |
|---|---|
| Host | Mouse |
| Clonality | Monoclonal |
| Clone No. | 2B11 |
| Isotype | IgG2A Kappa |
| Immunogen | C11orf17 (NP_065693.2, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GGATHVYRYHRGESKLHMCLDIGNGQRKDRKKTSLGPGGSYQISEHAPEASQPAENISKDLYIEVYPGTYSVTVGSNDLTKKTHVVAVDSGQSVDLVFPV. |
| Usage | |
|---|---|
| Application | WB, ELISA |
| Dilutions | Western Blot (1:500) |
| Reactivity | Human |
| Specificity | C11orf17 - chromosome 11 open reading frame 17. |
| Storage & Handling | |
|---|---|
| Storage Buffer | In 1X PBS, pH 7.4. |
| Preservative | No Preservative |
| Storage Temp. | Aliquot and store at -20 °C or -80 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.