Online Inquiry
BAIAP2L1 Antibody
SPA-00871
Size | Price |
0.1 mL | Online Inquiry |
25 µL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | BAIAP2L1 |
Gene Abbr. | BAIAP2L1 |
Gene ID | 55971 |
Full Name | BAR/IMD domain containing adaptor protein 2 like 1 |
Alias | IRTKS |
Introduction | BAIAP2L1 (Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1) may function as an adapter protein. It contains an IRSp53/MIM homology domain (IMD) that bundles actin filaments, and interacts with the small GTPase Rac. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to amino acids: ERSNVVRKDYDTLSKCSPKMPPAPSGRAYTSPLIDMFNNPATAAPNSQRVNNSTGTSEDPSLQRSVSVATGLNMMKKQKVKTIFPHTAGSN. |
Usage | |
---|---|
Application | WB, IF, IHC |
Dilutions | Western Blot (0.04-0.4 µg/mL); Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:500-1:1000) |
Reactivity | Human, Mouse, Rat |
Specificity | Specificity of human, mouse, rat BAIAP2L1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.