Online Inquiry
Bag-1 Antibody
SPA-00861
Size | Price |
0.025 mL | Online Inquiry |
0.05 mL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | Bag-1 |
Gene Abbr. | BAG1 |
Gene ID | 573 |
Full Name | BAG cochaperone 1 |
Alias | BAG-1, HAP, RAP46 |
Introduction | Bag-1 (Bcl-2-associated Athanogene 1) is a 31-kDa protein with an apparent molecular mass of 46 kDa that can bind to Bcl-2 and enhance its anti-apoptotic effect, resulting in increased protection from cell death induced by apoptotic stimuli. Bag-1 shares no significant homology with Bcl-2 or other Bcl-2 family proteins. The C-terminal region of Bag-1 binds the PDGF and HGF Receptor, and enhances growth factor-mediated protection from apoptosis. This represents a link between growth factor receptors and anti-apoptotic mechanisms. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to amino acids: GKSLKEMETPLSALGIQDGCRVMLIGKKNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQETE. |
Usage | |
---|---|
Application | IHC |
Dilutions | Immunohistochemistry (1:50-1:200) |
Reactivity | Human |
Specificity | Specificity of human Bag-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.