Bag-1 Antibody - CD BioSciences

service-banner

Bag-1 Antibody

Bag-1 Antibody

SPA-00861

Size Price
0.025 mL Online Inquiry
0.05 mL Online Inquiry
More Options Online Inquiry
Target Information
Target Name Bag-1
Gene Abbr. BAG1
Gene ID 573
Full Name BAG cochaperone 1
Alias BAG-1, HAP, RAP46
Introduction Bag-1 (Bcl-2-associated Athanogene 1) is a 31-kDa protein with an apparent molecular mass of 46 kDa that can bind to Bcl-2 and enhance its anti-apoptotic effect, resulting in increased protection from cell death induced by apoptotic stimuli. Bag-1 shares no significant homology with Bcl-2 or other Bcl-2 family proteins. The C-terminal region of Bag-1 binds the PDGF and HGF Receptor, and enhances growth factor-mediated protection from apoptosis. This represents a link between growth factor receptors and anti-apoptotic mechanisms.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: GKSLKEMETPLSALGIQDGCRVMLIGKKNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQETE.
Usage
Application IHC
Dilutions Immunohistochemistry (1:50-1:200)
Reactivity Human
Specificity Specificity of human Bag-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.