ATPB Antibody - CD BioSciences

service-banner

ATPB Antibody

ATPB Antibody

SPA-00771

Size Price
0.1 mL Online Inquiry
25 µL Online Inquiry
More Options Online Inquiry
Target Information
Target Name ATPB
Gene Abbr. ATP5F1B
Gene ID 506
Full Name ATP synthase F1 subunit beta
Alias ATP5B, ATPMB, ATPSB, HEL-S-271
Introduction ATP5B is a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). ATP5B is the beta subunit of the catalytic core.This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the beta subunit of the catalytic core. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Synthetic peptides corresponding to ATP5B(ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide) The peptide sequence was selected from the N terminal of ATP5B. Peptide sequence PIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAP The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB, IHC
Dilutions Western Blot (2.5 µg/mL); Immunohistochemistry (1:10-1:500)
Reactivity Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Rabbit, Yeast, Zebrafish
Specificity This product is specific to Subunit or Isoform: beta, mitochondrial.
Storage & Handling
Storage Buffer PBS and 2% Sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at -20 °C.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.