ATP6V1A Antibody - CD BioSciences

service-banner

ATP6V1A Antibody

ATP6V1A Antibody

SPA-00766

Size Price
0.1 mL Online Inquiry
More Options Online Inquiry
Target Information
Target Name ATP6V1A
Gene Abbr. ATP6V1A
Gene ID 523
Full Name ATPase H+ transporting V1 subunit A
Alias ARCL2D, ATP6A1, ATP6V1A1, HO68, IECEE3
Introduction This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is one of two V1 domain A subunit isoforms and is found in all tissues. Transcript variants derived from alternative polyadenylation exist. [provided by RefSeq]
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Synthetic peptides corresponding to ATP6V1A(ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A) The peptide sequence was selected from the N terminal of ATP6V1A. Peptide sequence SGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPR. The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB
Dilutions Western Blot (0.2-1 µg/mL)
Reactivity Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit
Specificity This product is specific to Subunit or Isoform: A.
Storage & Handling
Storage Buffer PBS and 2% Sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at -20 °C.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.