Online Inquiry
ATP-Citrate Lyase Antibody
SPA-00744
Size | Price |
0.1 mL | Online Inquiry |
25 µL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | ATP-Citrate Lyase |
Gene Abbr. | ACLY |
Gene ID | 47 |
Full Name | ATP citrate lyase |
Alias | ACL, ATPCL, CLATP |
Introduction | ATP-citrate lyase (ACL) is a homotetramer that catalyzes the formation of acetyl-CoA and oxaloacetate (OAA) in the cytosol, which is the key step for the biosynthesis of fatty acids, cholesterol and acetylcholine, as well as for glucogenesis. Nutrients and hormones regulate the expression level and phosphorylation of ATP-citrate lyase. It is phosphorylated by GSK-3 on Thr446 and Ser450. Ser455 of ATP-citrate lyase has been reported to be phosphorylated by PKA and Akt. Phosphorylation on Ser455 abolishes the homotropic allosteric regulation by citrate and enhances the catalytic activity of the enzyme. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to amino acids: CANQASETAVAKNQALKEAGVFVPRSFDELGEIIQSVYEDLVANGVIVPAQEVPPPTVPMDYSWARELGLIRKPASFMTSICDERGQELIYAGMPITE. |
Usage | |
---|---|
Application | WB, IF, IHC |
Dilutions | Western Blot (0.04-0.4 µg/mL); Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:20-1:50) |
MW(KDa) | 125 |
Reactivity | Human, Mouse, Rat |
Validation | Knockdown Validated. |
Specificity | Specificity of human, mouse, rat ATP Citrate Lyase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.