Online Inquiry
Atg12 Antibody
SPA-00659
Size | Price |
0.025 mg | Online Inquiry |
0.1 mg | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | Atg12 |
Gene Abbr. | ATG12 |
Gene ID | 9140 |
Full Name | autophagy related 12 |
Alias | APG12, APG12L, FBR93, HAPG12 |
Introduction | Autophagy is a catabolic process for the autophagosomic-lysosomal degradation of bulk cytoplasmic contents. Autophagy is generally activated by conditions of nutrient deprivation but has also been associated with a number of physiological processes including development, differentiation, neurodegeneration, infection, and cancer. The molecular machinery of autophagy was largely discovered in yeast and referred to as autophagy-related (Atg) genes. Formation of the autophagosome involves a ubiquitin-like conjugation system in which Atg12 is covalently bound to Atg5 and targeted to autophagosome vesicles. This conjugation reaction is mediated by the ubiquitin E1-like enzyme Atg7 and the E2-like enzyme Atg10. |
Product Details | |
---|---|
Host | Mouse |
Clonality | Monoclonal |
Clone No. | 2H8 |
Isotype | IgG1 Kappa |
Immunogen | ATG12 (AAH11033, 1 a.a. ~ 74 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIYLCESVLCSFPRPRSWNSL. |
Usage | |
---|---|
Application | WB, ELISA |
Dilutions | Western Blot (1:500) |
MW(KDa) | 16, 55 |
Reactivity | Human |
Specificity | ATG12 - ATG12 autophagy related 12 homolog (S. cerevisiae). |
Storage & Handling | |
---|---|
Storage Buffer | In 1X PBS, pH 7.4. |
Preservative | No Preservative |
Storage Temp. | Aliquot and store at -20 °C or -80 °C. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.