Ataxin-1 Antibody - CD BioSciences

service-banner

Ataxin-1 Antibody

Ataxin-1 Antibody

SPA-00609

Size Price
25 µg Online Inquiry
100 µg Online Inquiry
More Options Online Inquiry
Target Information
Target Name Ataxin-1
Gene Abbr. ATXN1
Gene ID 6310
Full Name ataxin 1
Alias ATX1, D6S504E, SCA1
Introduction Spinocerebellar ataxia 1 (SCA1), an autosomal dominant neurodegenerative disorder, is characterized by slurred speech, loss of limb coordination, and gait abnormalities resulting from the degeneration of cerebellar Purkinje cells and of a subset of brainstem neurons. Individuals with SCA1 have a highly polymorphic CAG repeat expansion encoding a polyglutamine tract in ataxin-1. Akt phosphorylates ataxin-1 at Ser776, which regulates an association with 14-3-3. This interaction increases ataxin-1 stabilization and accumulation resulting in enhanced neurodegeneration. In addition, HSP70 controls the effect that phosphorylation has on ataxin-1 stability.
Product Details
Host Mouse
Clonality Monoclonal
Clone No. S76-8
Isotype IgG2B
Immunogen Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
Usage
Application WB, IF, IHC, IP
Dilutions Western Blot (1:1000)
MW(KDa) 105
Reactivity Human, Mouse, Rat
Specificity Detects approx 85kDa.
Storage & Handling
Storage Buffer PBS (pH 7.4) and 50% Glycerol.
Preservative 0.1% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.