APPL Antibody - CD BioSciences

service-banner

APPL Antibody

APPL Antibody

SPA-00544

Size Price
25 µg Online Inquiry
100 µg Online Inquiry
More Options Online Inquiry
Target Information
Target Name APPL
Gene Abbr. APPL1
Gene ID 26060
Full Name adaptor protein, phosphotyrosine interacting with PH domain and leucine zipper 1
Alias APPL, DIP13alpha, MODY14
Introduction APPL, also known as DCC interacting protein 13 alpha (DIP13 alpha), is a widely expressed approximately 80 kDa intracellular adaptor protein. APPL contains two coiled-coil domains (aa 215-259 and aa 621-673), a pleckstrin homology domain (aa 277-375) and a phosphotyrosine interaction domain (PID) (aa 496-656). These domains and the cytoplasmic and nuclear localization of APPL enable it to associate with a range of molecules involved in multiple pathways. APPL mediates the insulin-sensitizing and anti-inflammatory effects of Adiponectin through direct interactions with AdipoR1 and AdipoR2. Within aa 2-373, human APPL shares 99% aa sequence identity with mouse and rat APPL.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: KIALLEPLLGYMQAQISFFKMGSENLNEQLEEFLANIGTSVQNVRREMDSDIETMQQTIEDLEVASDPLYVPDPDPTKFPVNR.
Usage
Application WB
Dilutions Western Blot (0.04-0.4 µg/mL)
Reactivity Human, Mouse, Rat
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS, pH 7.2, containing 40% glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.