Online Inquiry
APPL Antibody
SPA-00544
Size | Price |
25 µg | Online Inquiry |
100 µg | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | APPL |
Gene Abbr. | APPL1 |
Gene ID | 26060 |
Full Name | adaptor protein, phosphotyrosine interacting with PH domain and leucine zipper 1 |
Alias | APPL, DIP13alpha, MODY14 |
Introduction | APPL, also known as DCC interacting protein 13 alpha (DIP13 alpha), is a widely expressed approximately 80 kDa intracellular adaptor protein. APPL contains two coiled-coil domains (aa 215-259 and aa 621-673), a pleckstrin homology domain (aa 277-375) and a phosphotyrosine interaction domain (PID) (aa 496-656). These domains and the cytoplasmic and nuclear localization of APPL enable it to associate with a range of molecules involved in multiple pathways. APPL mediates the insulin-sensitizing and anti-inflammatory effects of Adiponectin through direct interactions with AdipoR1 and AdipoR2. Within aa 2-373, human APPL shares 99% aa sequence identity with mouse and rat APPL. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to amino acids: KIALLEPLLGYMQAQISFFKMGSENLNEQLEEFLANIGTSVQNVRREMDSDIETMQQTIEDLEVASDPLYVPDPDPTKFPVNR. |
Usage | |
---|---|
Application | WB |
Dilutions | Western Blot (0.04-0.4 µg/mL) |
Reactivity | Human, Mouse, Rat |
Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS, pH 7.2, containing 40% glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.