Androgen R/NR3C4 Antibody - CD BioSciences

service-banner

Androgen R/NR3C4 Antibody

Androgen R/NR3C4 Antibody

SPA-00510

Size Price
0.025 mL Online Inquiry
0.1 mL Online Inquiry
More Options Online Inquiry
Target Information
Target Name Androgen Receptor
Gene Abbr. AR
Gene ID 367
Full Name androgen receptor
Alias AIS, AR8, DHTR, HUMARA, HYSP1
Introduction The androgen receptor (AR) is an approx. 110 kDa androgen-dependent transcription factor that is a member of the steroid/nuclear receptor gene superfamily. The AR signaling pathway plays a key role in development and function of male reproductive organs, including the prostate and epididymis. AR also plays a role in nonreproductive organs, such as muscle, hair follicles, and brain. Abnormalities in the AR signaling pathway have been linked to a number of diseases, including prostate cancer, Kennedy's disease and male infertility. The PI3K/Akt signaling pathway plays an important role in regulating AR activity through phosphorylation of AR at Ser213/210 and Ser791/790. Growth factors or cytokines may induce phosphorylation of AR through the PI3K/Akt pathway. IGF-1 activates the phosphatidylinositol 3-kinase(PI3K)/AKT pathway in LNCap at high passage number and increases phosphorylation of of AR at Ser213/210 (see western blot) and Ser791/790 (Lin et al. 2003). The western blot results also show that inhibition of the PI3K/Akt pathway by LY294002 prior to incubation with IGF-1 suppressed AR phosphorylation at Ser213/210. Activation of the PI3K/AKt pathway is thought to have a survival role in prostate cancer by protecting cells from apoptosis.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to the following amino acid sequence: LSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYTKGLEG.
Usage
Application IF
Dilutions Immunofluorescence (0.25-2 µg/mL)
Reactivity Human
Specificity Specificity of human Androgen R/NR3C4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.