Aminoacylase/ACY1 Antibody - CD BioSciences

service-banner

Aminoacylase/ACY1 Antibody

Aminoacylase/ACY1 Antibody

SPA-00438

Size Price
100 µL Online Inquiry
More Options Online Inquiry
Target Information
Target Name Aminoacylase/ACY1
Gene Abbr. ACY1
Gene ID 95
Full Name aminoacylase 1
Alias ACY-1, ACY1D, HEL-S-5
Introduction Aminoacylase-1 is a cytosolic, homodimeric, zinc-binding enzyme that catalyzes the hydrolysis of acylated L-amino acids to L-amino acids and acyl group, and has been postulated to function in the catabolism and salvage of acylated amino acids. ACY1 has been assigned to chromosome 3p21.1, a region reduced to homozygosity in small-cell lung cancer (SCLC), and its expression has been reported to be reduced or undetectable in SCLC cell lines and tumors. The amino acid sequence of human aminoacylase-1 is highly homologous to the porcine counterpart, and ACY1 is the first member of a new family of zinc-binding enzymes.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: SVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQA AGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCK.
Usage
Application IHC
Dilutions Immunohistochemistry (1:200-1:500)
Reactivity Human
Specificity Specificity of human Aminoacylase/ACY1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.