Online Inquiry
AMCase/CHIA Antibody
SPA-00421
| Size | Price |
| 100 µL | Online Inquiry |
| 20 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | AMCase |
| Gene Abbr. | CHIA |
| Gene ID | 27159 |
| Full Name | chitinase acidic |
| Alias | AMCASE, CHIT2, TSA1902 |
| Introduction | CHIA belongs to the glycosyl hydrolase 18 family. Chitinase class II subfamily. It contains 1 chitin-binding type-2 domain. The protein degrades chitin and chitotriose. And it may participate in the defense against nematodes and other pathogens. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: DTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYE. |
| Usage | |
|---|---|
| Application | IHC |
| Dilutions | Immunohistochemistry (1:50-1:200) |
| Reactivity | Human |
| Specificity | Specificity of human AMCase/CHIA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.