ALK-1 Antibody - CD BioSciences

service-banner

ALK-1 Antibody

ALK-1 Antibody

SPA-00407

Size Price
25 µg Online Inquiry
100 µg Online Inquiry
More Options Online Inquiry
Target Information
Target Name ALK-1
Gene Abbr. ACVRL1
Gene ID 94
Full Name activin A receptor like type 1
Alias ACVRLK1, ALK-1, ALK1, HHT, HHT2
Introduction Transforming Growth Factor beta (TGF-beta ) superfamily ligands exert their biological activities via binding to heteromeric receptor complexes of two types (I and II) of serine/threonine kinases. Type II receptors are constitutively active kinases that phosphorylate type I receptors upon ligand binding. In turn, activated type I kinases phosphorylate downstream signaling molecules including the various smads. Transmembrane proteoglycans, including the type III receptor (betaglycan) and endoglin, can bind and present some of the TGF-beta superfamily ligands to type I and II receptor complexes and enhance their cellular responses. Seven type I receptors (also termed activin receptor-like kinase (ALK)) and five type II receptors have been isolated from mammals. ALK-2, -3, -4, -5, and -6 are also known as Activin R1A, BMPR-1A, Activin R1B, TGF-beta R1, and BMPR-1B, respectively, reflecting their ligand preferences. Evidence suggests that TGF-beta 1, TGF-beta 3 and an unknown ligand present in serum can activate chimeric ALK-1. ALK-1 shares with other type I receptors a cysteine-rich domain with conserved cysteine spacing in the extracellular region, and a glycine- and serine-rich domain (the GS domain) preceding the kinase domain. ALK-1 is expressed highly in endothelial cells and other highly vascularized tissues. The expression patterns of ALK-1 parallels that of endoglin. Mutations in ALK-1 as well as in endoglin are associated with hereditary hemorrhagic telangiectasia (HHT), suggesting a critical role for ALK-1 in the control of blood vessel development or repair. Human and mouse ALK-1 share approximately 71% amino acid sequence identity in their extracellular regions.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQL.
Usage
Application WB, IHC
Dilutions Western Blot (0.04-0.4 µg/mL); Immunohistochemistry (1:50-1:200)
Reactivity Human
Specificity Specificity of human ALK-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.