Online Inquiry
ALK-1 Antibody
SPA-00407
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | ALK-1 |
| Gene Abbr. | ACVRL1 |
| Gene ID | 94 |
| Full Name | activin A receptor like type 1 |
| Alias | ACVRLK1, ALK-1, ALK1, HHT, HHT2 |
| Introduction | Transforming Growth Factor beta (TGF-beta ) superfamily ligands exert their biological activities via binding to heteromeric receptor complexes of two types (I and II) of serine/threonine kinases. Type II receptors are constitutively active kinases that phosphorylate type I receptors upon ligand binding. In turn, activated type I kinases phosphorylate downstream signaling molecules including the various smads. Transmembrane proteoglycans, including the type III receptor (betaglycan) and endoglin, can bind and present some of the TGF-beta superfamily ligands to type I and II receptor complexes and enhance their cellular responses. Seven type I receptors (also termed activin receptor-like kinase (ALK)) and five type II receptors have been isolated from mammals. ALK-2, -3, -4, -5, and -6 are also known as Activin R1A, BMPR-1A, Activin R1B, TGF-beta R1, and BMPR-1B, respectively, reflecting their ligand preferences. Evidence suggests that TGF-beta 1, TGF-beta 3 and an unknown ligand present in serum can activate chimeric ALK-1. ALK-1 shares with other type I receptors a cysteine-rich domain with conserved cysteine spacing in the extracellular region, and a glycine- and serine-rich domain (the GS domain) preceding the kinase domain. ALK-1 is expressed highly in endothelial cells and other highly vascularized tissues. The expression patterns of ALK-1 parallels that of endoglin. Mutations in ALK-1 as well as in endoglin are associated with hereditary hemorrhagic telangiectasia (HHT), suggesting a critical role for ALK-1 in the control of blood vessel development or repair. Human and mouse ALK-1 share approximately 71% amino acid sequence identity in their extracellular regions. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQL. |
| Usage | |
|---|---|
| Application | WB, IHC |
| Dilutions | Western Blot (0.04-0.4 µg/mL); Immunohistochemistry (1:50-1:200) |
| Reactivity | Human |
| Specificity | Specificity of human ALK-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.