Online Inquiry
AHCYL1 Antibody
SPA-00256
Size | Price |
0.1 mL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | AHCYL1 |
Gene Abbr. | AHCYL1 |
Gene ID | 10768 |
Full Name | adenosylhomocysteinase like 1 |
Alias | DCAL, IRBIT, PPP1R78, PRO0233, XPVKONA |
Introduction | AHCYL1 belongs to the adenosylhomocysteinase family.The protein, an inositol 1,4,5-trisphosphate receptor-binding protein, specifically binds to and activates pancreas-type Na+/HCO3- cotransporter 1 (pNBC1).The regulation through AHCYL1 enables NBC1 variants to have different physiological roles. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Synthetic peptides corresponding to AHCYL1(S-adenosylhomocysteine hydrolase-like 1) The peptide sequence was selected from the N terminal of AHCYL1. Peptide sequence MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQE. The peptide sequence for this immunogen was taken from within the described region. |
Usage | |
---|---|
Application | WB |
Dilutions | Western Blot (1:100-1:2000) |
Reactivity | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Rabbit |
Storage & Handling | |
---|---|
Storage Buffer | PBS and 2% Sucrose. |
Preservative | 0.09% Sodium Azide |
Storage Temp. | Store at -20 °C. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.