AHCYL1 Antibody - CD BioSciences

service-banner

AHCYL1 Antibody

AHCYL1 Antibody

SPA-00256

Size Price
0.1 mL Online Inquiry
More Options Online Inquiry
Target Information
Target Name AHCYL1
Gene Abbr. AHCYL1
Gene ID 10768
Full Name adenosylhomocysteinase like 1
Alias DCAL, IRBIT, PPP1R78, PRO0233, XPVKONA
Introduction AHCYL1 belongs to the adenosylhomocysteinase family.The protein, an inositol 1,4,5-trisphosphate receptor-binding protein, specifically binds to and activates pancreas-type Na+/HCO3- cotransporter 1 (pNBC1).The regulation through AHCYL1 enables NBC1 variants to have different physiological roles.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Synthetic peptides corresponding to AHCYL1(S-adenosylhomocysteine hydrolase-like 1) The peptide sequence was selected from the N terminal of AHCYL1. Peptide sequence MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQE. The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB
Dilutions Western Blot (1:100-1:2000)
Reactivity Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Rabbit
Storage & Handling
Storage Buffer PBS and 2% Sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at -20 °C.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.