ADAMTS5 Antibody - CD BioSciences

service-banner

ADAMTS5 Antibody

ADAMTS5 Antibody

SPA-00229

Size Price
0.1 mL Online Inquiry
More Options Online Inquiry
Target Information
Target Name ADAMTS5
Gene Abbr. ADAMTS5
Gene ID 11096
Full Name ADAM metallopeptidase with thrombospondin type 1 motif 5
Alias ADAM-TS 11, ADAM-TS 5, ADAM-TS5, ADAMTS-11, ADAMTS-5
Introduction ADAMTS5, also known as aggrecanase-2, is a Metallopeptidase M12B type protease that is responsible for degradation of the articular cartilage protein aggrecan. The protein contains a signal sequence, a prodomain with both a potential cysteine switch and a furin cleavage site, a metalloproteinase domain with a conserved zinc-binding motif and a 'met turn,' a disintegrin-like domain, and a spacer region between a thrombospondin type 1 motif and thrombospondin submotif. At least four transcript variants have been reported. ADAMTS5 has been implicated in inflammatory joint diseases. ADAMTS5 expression has been documented in a range of normal human tissues.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to the following amino acid sequence: KSTPKVNSVTSHGSNKVGSHTSQPQWVTGPWLACSRTCDTGWHTRTVQCQDGNRKLAKGCPLSQRPSAFKQCLLKKC.
Usage
Application IF
Dilutions Immunofluorescence (0.25-2 µg/mL)
Reactivity Human, Mouse
Specificity Specificity of human ADAMTS5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.