Online Inquiry
ADAMTS3 Antibody
SPA-00223
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | ADAMTS3 |
| Gene Abbr. | ADAMTS3 |
| Gene ID | 9508 |
| Full Name | ADAM metallopeptidase with thrombospondin type 1 motif 3 |
| Alias | ADAMTS-4, HKLLS3 |
| Introduction | ADAMTS3 (A disintegrin and metalloprotease with thrombospondin motifs 3; also PC II-NP) is a 140-150 kDa member of the ADAMTS family of Zn metalloproteases. It is expressed by osteoblasts, chrondrocytes, myoepithelium and fibroblasts, and participates in collagen maturation. Together with ADAMTS2 and TS14, ADAMTS3 is known to process the N-terminus of procollagen. In particular, it cleaves the N-terminal globular region of collagen I and II, leading to fibril formation. Mature human proADAMTS3 is a secreted, 1185 amino acid (aa) glycoprotein. It is highly modular and contains a proregion (aa 38-201), a peptidase M12B domain (aa 256-460), a disintegrin region (aa 470-550), four TSP type I sequences (aa 551-1015), and a PLAC domain (aa 1015-1054). There are two potential splice variants. One shows a 38 aa substitution for aa 169-1205, while another shows an alternative start site at Met171. Over aa 19-712, human ADAMTS3 shares 91% aa identity with mouse ADAMTS3. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: QAGNEEMVQIDLPIKRYREYELVTPVSTNLEGRYLSHTLSASHKKRSARDVSSNPEQLFFNITAFGKDFHLRLKPNTQL. |
| Usage | |
|---|---|
| Application | IHC |
| Dilutions | Immunohistochemistry (1:20-1:50) |
| Reactivity | Human |
| Specificity | Specificity of human ADAMTS3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.