Online Inquiry
ADAMTS3 Antibody
SPA-00222
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | ADAMTS3 |
| Gene Abbr. | ADAMTS3 |
| Gene ID | 9508 |
| Full Name | ADAM metallopeptidase with thrombospondin type 1 motif 3 |
| Alias | ADAMTS-4, HKLLS3 |
| Introduction | ADAMTS3 (A disintegrin and metalloprotease with thrombospondin motifs 3; also PC II-NP) is a 140-150 kDa member of the ADAMTS family of Zn metalloproteases. It is expressed by osteoblasts, chrondrocytes, myoepithelium and fibroblasts, and participates in collagen maturation. Together with ADAMTS2 and TS14, ADAMTS3 is known to process the N-terminus of procollagen. In particular, it cleaves the N-terminal globular region of collagen I and II, leading to fibril formation. Mature human proADAMTS3 is a secreted, 1185 amino acid (aa) glycoprotein. It is highly modular and contains a proregion (aa 38-201), a peptidase M12B domain (aa 256-460), a disintegrin region (aa 470-550), four TSP type I sequences (aa 551-1015), and a PLAC domain (aa 1015-1054). There are two potential splice variants. One shows a 38 aa substitution for aa 169-1205, while another shows an alternative start site at Met171. Over aa 19-712, human ADAMTS3 shares 91% aa identity with mouse ADAMTS3. |
| Product Details | |
|---|---|
| Host | Mouse |
| Clonality | Monoclonal |
| Clone No. | 1D6 |
| Isotype | IgG2A Kappa |
| Immunogen | ADAMTS3 (NP_055058.1, 1048 a.a. ~ 1128 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ESCSKRSSTLPPPYLLEAAETHDDVISNPSDLPRSLVMPTSLVPYHSETPAKKMSLSSISSVGGPNAYAAFRPNSKPDGAN. |
| Usage | |
|---|---|
| Application | WB, ELISA |
| Reactivity | Human |
| Specificity | This product is specific for Human ADAMTS3 monoclonal antibody (M08), clone 1D6 [Gene ID: 9508]. |
| Storage & Handling | |
|---|---|
| Storage Buffer | In 1X PBS, pH 7.4. |
| Preservative | No Preservative |
| Storage Temp. | Aliquot and store at -20 °C or -80 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.