Online Inquiry
ADAMTS2 Antibody
SPA-00218
Size | Price |
0.1 mL | Online Inquiry |
25 µL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | ADAMTS2 |
Gene Abbr. | ADAMTS2 |
Gene ID | 9509 |
Full Name | ADAM metallopeptidase with thrombospondin type 1 motif 2 |
Alias | ADAM-TS2, ADAMTS-2, ADAMTS-3, EDSDERMS, NPI |
Introduction | ADAMTS2 is a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The enzyme encoded by this gene excises the N-propeptide of type I, type II and type V procollagens. Mutations in this gene cause Ehlers-Danlos syndrome type VIIC, a recessively inherited connective-tissue disorder. Alternative splicing results in two transcript variants. The short transcript encodes a protein which has no significant procollagen N-peptidase activity. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Immunogen | Synthetic peptide directed towards the middle terminal region of human ADAMTS2. Peptide sequence: EHANSSRRRARRHAADDDYNIEVLLGVDDSVVQFHGKEHVQKYLLTLMNI The peptide sequence for this immunogen was taken from within the described region. |
Usage | |
---|---|
Application | WB |
Reactivity | Human |
Storage & Handling | |
---|---|
Storage Buffer | PBS, 2% Sucrose. |
Preservative | 0.09% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.