Activin RIIB Antibody - CD BioSciences

service-banner

Activin RIIB Antibody

Activin RIIB Antibody

SPA-00192

Size Price
25 µg Online Inquiry
100 µg Online Inquiry
More Options Online Inquiry
Target Information
Target Name Activin Receptor
Gene Abbr. ACVR2B
Gene ID 93
Full Name activin A receptor type 2B
Alias ACTRIIB, ActR-IIB, HTX4
Introduction Activin isoforms and other members of the TGF-beta superfamily exert their biological effects by binding to heteromeric complexes of a type I and a type II serine-threonine kinase receptor, both of which are essential for signal transduction. To date, seven type I and five type II receptors, including the two type I and the two type II activin receptors, designated ActR-I(A), ActR-IB, ActR-II(A) and ActR-IIB, have been cloned from mammals. Through alternative mRNA splicing, multiple ActR-IIB isoforms can also be generated, adding to the complexity of the activin receptor system. Different activin isoforms bind with different high-affinities to the various type II isoforms. Type I activin receptors do not bind directly to activin, but will associate with the type II receptor-activin complex and initiate signal transduction. Besides the activin isoforms, ActR-II will also bind inhibin, BMP-2 and BMP-7 with lower affinities. ActR-I can also bind and form signaling complexes with the BMP-2/7-bound BMPR-II. Activin type II receptors are highly conserved. Human, mouse and rat type II activin receptors share greater than 98% amino acid sequence homology. Recombinant soluble activin type II receptors bind activin with high affinity, and are potent activin antagonists.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: ECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPP.
Usage
Application WB, IHC
Dilutions Western Blot (0.04-0.4 µg/mL); Immunohistochemistry (1:200-1:500)
Reactivity Human, Mouse, Rat
Validation Knockdown Validated.
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.