Online Inquiry
Activin RIIA Antibody
SPA-00188
Size | Price |
25 µg | Online Inquiry |
100 µg | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | Activin Receptor |
Gene Abbr. | ACVR2A |
Gene ID | 92 |
Full Name | activin A receptor type 2A |
Alias | ACTRII, ACVR2 |
Introduction | Activin isoforms and other members of the TGF-beta superfamily exert their biological effects by binding to heteromeric complexes of a type I and a type II serine-threonine kinase receptor, both of which are essential for signal transduction. To date, seven type I and five type II receptors, including the two type I and the two type II activin receptors, designated ActR-I(A), ActR-IB, ActR-II(A) and ActR-IIB, have been cloned from mammals. Through alternative mRNA splicing, multiple ActR-IIB isoforms can also be generated, adding to the complexity of the activin receptor system. Different activin isoforms bind with different high-affinities to the various type II isoforms. Type I activin receptors do not bind directly to activin, but will associate with the type II receptor-activin complex and initiate signal transduction. Besides the activin isoforms, ActR-II will also bind inhibin, BMP-2 and BMP-7 with lower affinities. ActR-I can also bind and form signaling complexes with the BMP-2/7-bound BMPR-II. Activin type II receptors are highly conserved. Human, mouse and rat type II activin receptors share greater than 98% amino acid sequence homology. Recombinant soluble activin type II receptors bind activin with high affinity, and are potent activin antagonists. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to amino acids: CEGNMCNEKFSYFPEMEVTQPTSNPVTPKPPYYN. |
Usage | |
---|---|
Application | IHC |
Dilutions | Immunohistochemistry (1:20-1:50) |
Reactivity | Human, Mouse, Rat |
Specificity | Specificity of human Activin RIIA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.