Online Inquiry
17 beta-HSD14/HSD17B14 Antibody
SPA-05257
| Size | Price |
| 0.1 mL | Online Inquiry |
| 25 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | HSD17B14 |
| Gene Abbr. | HSD17B14 |
| Gene ID | 51171 |
| Full Name | hydroxysteroid 17-beta dehydrogenase 14 |
| Alias | DHRS10, SDR47C1, retSDR3 |
| Introduction | HSD-17b14 (hydroxysteroid (17-beta) dehydrogenase type14), also called 17bHSD14 or DHRS10, is a cytoplasmic 17beta-hydroxysteroid dehydrogenase that is a member of the SDR (short-chain dehydrogenase/reductase) family. It is a 270 amino acid, approximately 30 kDa protein with mRNA highly expressed in brain, placenta, liver and kidney. It converts estradiol to estrone, thus inactivating it, and is thought to regulate activity of estrogens and possibly dihydroepiandrosterone (DHEA) in the placenta and central nervous system. Human HSD-17b14 shares 80.5% amino acid sequence identity with mouse and rat HSD-17b14. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Synthetic peptides corresponding to HSD17B14(hydroxysteroid (17-beta) dehydrogenase 14) The peptide sequence was selected from the middle region of HSD17B14. Peptide sequence QPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIP. The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB |
| Dilutions | Western Blot (1:100-1:2000) |
| Reactivity | Human |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS and 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at -20 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.